Professional manufacture steroid powders , Injection steroid liquid , Peptides , HGH176-191, Sarms , Pharmaceutical raw materials ( Phenacetin ) , GBL , Local anesthetics , BB , BA etc.

Home ProductsGrowth Hormone Peptides

CAS 863288-34-0 CJC-1295 Body Building Peptides for Increase GH Production

Certification
Good quality Androgenic Anabolic Steroids for sales
Good quality Androgenic Anabolic Steroids for sales
It's an unforgetable experience . I was surprise about discreet package and fast delivery when I order in first time !

—— Aitor Parazation-Netherlands

Safety pass custom , nice package and super quality are my best favorable . Yes , they can do it and they have done that . I'm so happy...

—— Michael Decapvcca-UK

I fazer negócios com Eric, ele é sempre responsável por seus clientes. Quando cheguei em apuros, ele iria me ajudar a resolvê-los. sentir-se melhor

—— PRISCILLA DE OLIVEIRA-Brasil

I'm Online Chat Now

CAS 863288-34-0 CJC-1295 Body Building Peptides for Increase GH Production

China CAS 863288-34-0 CJC-1295 Body Building Peptides for Increase GH Production supplier
CAS 863288-34-0 CJC-1295 Body Building Peptides for Increase GH Production supplier CAS 863288-34-0 CJC-1295 Body Building Peptides for Increase GH Production supplier CAS 863288-34-0 CJC-1295 Body Building Peptides for Increase GH Production supplier

Large Image :  CAS 863288-34-0 CJC-1295 Body Building Peptides for Increase GH Production

Product Details:

Place of Origin: MADE IN CHINA
Brand Name: NJBN STEROID
Certification: ISO9001 , SGS , KOSHER
Model Number: 863288-34-0

Payment & Shipping Terms:

Minimum Order Quantity: 10g
Price: Negotiation
Packaging Details: 2mg/vial ,10vials/kit ,1g/bag
Delivery Time: 4~6 working days after payment by Express courier
Payment Terms: Western union,Moneygram,T/T & Bitcoin
Supply Ability: 1500kg/month
Contact Now
Detailed Product Description
Usage: Increase GH Production CAS: 863288-34-0
Market: Global Appearance: White Powder
Minimum Order Quantity: 10g Sample: Free
High Light:

testosterone peptide hormone

,

steroid peptide hormones

Hot Sell Body Building Peptides CAS 863288-34-0 CJC-1295 for Increase GH Production

 

Quick Detail:

 

Product Name CJC1295
Synonyms CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide;CJC-1295 Acetate;CJC1295 with out DAC
CAS register number 863288-34-0
Molecular formula C159H258N46O45
Product Categories Peptides
Assay 99%
Appearance white powder
Usage Increase GH Production
Minimum order quantity 10g
Shipping By express courier
Shipping leading time Within 24 hours after receiving the payment
Payment options Western Union , MoneyGram , T/T , Bitcoin
Price Negotiated

 

Description:

 

1.by Bill RobertsCJC-1295 is an injectable peptide used to increase GH production. This peptide is a growth hormone releasing hormone (GHRH) mimetic, or analog. That is to say, it works in the same way as GHRH, and may be referred to as being a GHRH.The principal use of CJC-1295 is to provide increased GH levels, which also results in increased IGF-1levels. An increase in these levels can aid fat loss and in some instances can aid muscle gain as well. Generally, a product in the GHRH category, including CJC-1295, is chosen as an alternate to using GH, and only rarely is combined with GH.

 

2.The other principal GHRH product is Mod GRF 1-29, which in most instances I recommend over CJC-1295. The products differ in their duration of action. Mod GRF has an approximately-ideal short duration of action allowing pulsatile dosing, whereas CJC-1295 has an extended duration of action which prevents such dosing.It’s important to avoid confusing CJC-1295 with “CJC-1295 w/o DAC.” The latter is not CJC-1295, but rather is misnamed Mod GRF. When a peptide doesn’t have DAC, it’s not CJC-1295.CJC 1295 is sometimes marketed as “CJC-1295 with DAC.” This simply is CJC-1295.

 

When to use CJC-1295

 

1.This product is most suited to instances where an individual wishes to inject infrequently and is seeking substantive support for GH production rather than a maximum or near-maximum increase. This is because the flat blood levels it provides do not match up well with pulsatile dosing, which is needed for greatest effect. The steady levels can provide very good support for natural GH pulses, however.

 

2.Relatively rarely, adverse side effects associated with excessive GH use, such as pain from nerve compression (such as carpal tunnel pain), excessive water retention, or reduced insulin sensitivity can occur from CJC-1295 use. The cause is stimulation of a greater amount of GH production than is suitable for the individual case. The solution is to discontinue use until the problem is resolved, and to reduce dosage when resuming use.for ongoing support of GH production, at doses recommended below, CJC-1295 does not need to be cycled.

 

How to use CJC-1295

 

1.CJC 1295 is typically provided in vials containing 2 or 5 mg of lyophylized powder, though the amount can vary. The contents should be reconstituted by adding a convenient amount of sterile or bacteriostatic water. If for example 2 mL is chosen and the dosing of the vial is 2 mg, the resulting solution then has a concentration of 1 mg/mL, or 1000 mcg/mL.


2.At time of dosing, an insulin syringe is used to draw and then inject the desired amount. In the above example, a 1000 mcg dose would require a volume of 1 mL, or “100 IU” as marked on an insulin syringe.

Injection may be subcutaneous, intramuscular, or intravenous according to personal preference. If desired, peptide solutions from other vials, such as a vial of a GHRP product, may also be drawn into the same syringe, if there is room. This reduces the total number of injections required.when recommending CJC 1295, I ordinarily recommend a dosage of 1000 mcg at a time, twice per week.

 

Application: 

 

1.CJC-1295 acts for much longer than pure GRF. It acts on the pituitary gland and keeps stimulating the release of growth hormone in pulses. The reason why it acts in pulses is because the axis of the human growth hormone controls how much of the hormone can remain in the body at a time. This maintains the homeostatic environment in the body.

 

2.The DAC technology in the CJC-1295 enables the compound to bind itself covalently with any circulating albumin, after it has been administered through a subcutaneous injection. However, the reason why the half-life could be extended from a few minutes to several days is more profound. The reactive group in the CJC-1295 binds to a peptide through bioconjugation. The peptide then finds a neucleophilic unit within the blood and reacts with it in order to create a firmer bond.

 

3.When using any GHRH, it should always be remembered that positive results cannot be achieved overnight. These compounds act steadily over time, and the best results can be achieved slowly, and with a nutritious diet and a proper exercise regime. Also, these peptides are not sex-specific, so they do not have any androgenic effects. They can be used by women in the same dosages that men do.

 

Why you choose Us :

 

  • High quality with competitive price

We are manufacturer and can provide high quality products with competitive price , offering free samples totest , a few shipping fee only.

 

  • Flexible Payment term

We accept every payment term , such as T/T , Bitcoin , Moneygram , Western Union.

 

  • Fast and safe delivery

 

1)Parcel can be sent out in 24 hours after comfirming payment.
2) Various transportation methods for your choice , such as EMS , FedEx , TNT , DHL , USP.
3) We have our own agent who can help us ship our products fastly and safely , and we have enough stock in there for transferring.
4)We have special way could ship 10g to sveral kg products a time. We offer melting powder into liquid service. And ship the liquid in special package ways.
5)Offer the latest tracking number for you to check.

 

  • We have clients throughout the world

 

1)Professional service and rich experience make customers feel comfortable and trust us.
2)Adequate stock(such as Anti Estrogen Steroids) and fast delivery meet their demand.
3)Market feedback and products feedback will be appreciated, meeting customers's requirement is our responsibility.
4) High quality and competitive price gain the trust and praise from the customers around the world.

 

  • Good after-sales service​

 

1)Tell the package update ASAP , and will try best solve when customer encountered various problems.
2)We will teach you recipes and instructions for all kind of steroid to turn powder into liquid , and liquid become sterile ones.

 

Contacting Information:

Skype:teresa556678

Contact Person:Teresa

Email:teresa@chembj.com

Whatsapp:+8617327095740

Website : www.realanabolicsteroids.com

 

CAS 863288-34-0 CJC-1295 Body Building Peptides for Increase GH Production

 

Contact Details
Nanjing Bangnuo Biotechnology Co., Ltd

Contact Person: CPSS

Tel: +8617327093119

Send your inquiry directly to us (0 / 3000)