Professional manufacture steroid powders , Injection steroid liquid , Peptides , HGH176-191, Sarms , Pharmaceutical raw materials ( Phenacetin ) , GBL , Local anesthetics , BB , BA etc.

Home Products

testosterone peptide hormone

Certifications
Good quality Androgenic Anabolic Steroids for sales
Good quality Androgenic Anabolic Steroids for sales
Customer Reviews
It's an unforgetable experience . I was surprise about discreet package and fast delivery when I order in first time !

—— Aitor Parazation-Netherlands

Safety pass custom , nice package and super quality are my best favorable . Yes , they can do it and they have done that . I'm so happy...

—— Michael Decapvcca-UK

I fazer negócios com Eric, ele é sempre responsável por seus clientes. Quando cheguei em apuros, ele iria me ajudar a resolvê-los. sentir-se melhor

—— PRISCILLA DE OLIVEIRA-Brasil

I'm Online Chat Now

testosterone peptide hormone

(67)
China Safe Peptide Protein Hormones Sermorelin CAS 86168-78-7 for Increasing Hormone factory

Safe Peptide Protein Hormones Sermorelin CAS 86168-78-7 for Increasing Hormone

Safe Peptide Protein Hormones Sermorelin CAS 86168-78-7 for Increasing Hormone Quick Details of Growth Hormone Peptides Sermorelin Product name Sermorelin Other Name SERMORELIN;SERMORELIN ACETATE;GROWTH HORMONE ... Read More
2018-07-26 10:44:10
China Fat Loss Legal Growth Hormone Peptides Ipamorelin CAS 170851-70-4 factory

Fat Loss Legal Growth Hormone Peptides Ipamorelin CAS 170851-70-4

Fat Loss Legal Growth Hormone Peptides Ipamorelin CAS 170851-70-4 Growth Hormone Peptides Quick Detail : Ipamorelin CAS:170851-70-4 MF:C38H49N9O5 MW:711.863 Packing:5mg/vial, 10vial/box Appearance: White powder ... Read More
2018-07-26 10:36:57
China Triptorelin Acetate 57773-63-4 Bodybuilding Polypeptide Hormone Powders Triptorelin 2mg factory

Triptorelin Acetate 57773-63-4 Bodybuilding Polypeptide Hormone Powders Triptorelin 2mg

Triptorelin Acetate 57773-63-4 Bodybuilding Polypeptide Hormones Triptorelin 2mg Buy Online Quick Details for Triptorelin Product Name : Triptorelin Acetate Cas No.: 57773-63-4 Sequence: Glp-His-Trp-Ser-Tyr-D... Read More
2018-07-25 12:02:02
China DSIP Growth Hormone Peptides CAS 62568-57-4 98% Sleep  Inducing Peptide factory

DSIP Growth Hormone Peptides CAS 62568-57-4 98% Sleep Inducing Peptide

DSIP Growth Hormone Peptides CAS 62568-57-4 98% Sleep Inducing Peptide Product Details: Product name DSIP CAS 62568-57-4 Sequence TRP-ALA-GLY-GLY-ASP-ALA-SER-GLY-GLU MF C35H48N10O15 MW 848.813620 Purity 9% ... Read More
2018-07-26 10:59:36
China Healthy Growth Hormone Peptides Injectable Polypeptide Hormones GHRP-6 factory

Healthy Growth Hormone Peptides Injectable Polypeptide Hormones GHRP-6

Healthy Growth Hormone Peptides Injectable Polypeptide Hormones GHRP-6 Product Details Product name GHRP-6 Cas No. 87616-84-0 Molecular Formula C46H56N12O6 Molecular Weight 873.01 Purity 99.9% Appearance White ... Read More
2016-11-11 10:23:46
China 97% Min 10mg/vial Growth Hormone Peptides HGH PT-141 32780-32-8 For Sexual Disorder factory

97% Min 10mg/vial Growth Hormone Peptides HGH PT-141 32780-32-8 For Sexual Disorder

98% 10mg/vial Growth Hormone Peptides HGH PT-141 32780-32-8 For Sexual Disorder Growth Hormone Peptides PT-141 Basic Infor: Product name: PT-141 Specification: 10mg/vial CAS: 32780-32-8 MF: C50H69N15O10 MW: ... Read More
2018-07-26 10:16:23
China Muscle Building Peptides , GHRP-6 87616-84-0 Growth Hormone Peptides10mg / vial factory

Muscle Building Peptides , GHRP-6 87616-84-0 Growth Hormone Peptides10mg / vial

Muscle Building Peptides , GHRP-6 87616-84-0 Growth Hormone Peptides10mg / vial Product Name GHRP-6 Alias GHRP-6 (Growth hormone releasing peptide) CAS 87616-84-0 MF C46H56N12O6 Einecs N/A Molecular Weight 873... Read More
2018-07-25 10:57:26
China GHRP-6 CAS 87616-84-0 Growth Hormone Peptides For Muscle Gain White Powder factory

GHRP-6 CAS 87616-84-0 Growth Hormone Peptides For Muscle Gain White Powder

GHRP-6 CAS 87616-84-0 Growth Hormone Peptides For Muscle Gain White Powder Basic Infomation: Product Name GHRP-6 Alias GHRP-6 ACETATE CAS 87616-84-0 Purity 99.0% Grade Pharmaceutical Grade Brand Name NJBN ... Read More
2018-07-26 10:04:44
China CAS 863288-34-0 CJC-1295 Body Building Peptides for Increase GH Production factory

CAS 863288-34-0 CJC-1295 Body Building Peptides for Increase GH Production

Hot Sell Body Building Peptides CAS 863288-34-0 CJC-1295 for Increase GH Production Quick Detail: Product Name CJC1295 Synonyms CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl... Read More
2018-07-25 17:29:43
China Legal Natural Growth Hormone Peptides HGH Fragment Polypeptide Frag CAS 176-191 2mg factory

Legal Natural Growth Hormone Peptides HGH Fragment Polypeptide Frag CAS 176-191 2mg

Legal Natural Growth Hormone Peptides HGH Fragment Polypeptide Frag CAS 176-191 2mg Quick Detail Product name Frag 176 191 Other name Testoviron Fragment 177-191, AOD-9604 CAS register number 221231-10-3 Grade ... Read More
2016-11-11 10:23:46
Page 4 of 7|< 1 2 3 4 5 6 7 >|