Professional manufacture steroid powders , Injection steroid liquid , Peptides , HGH176-191, Sarms , Pharmaceutical raw materials ( Phenacetin ) , GBL , Local anesthetics , BB , BA etc.

Home Products

injectable testosterone steroids

Certifications
Good quality Androgenic Anabolic Steroids for sales
Good quality Androgenic Anabolic Steroids for sales
Customer Reviews
It's an unforgetable experience . I was surprise about discreet package and fast delivery when I order in first time !

—— Aitor Parazation-Netherlands

Safety pass custom , nice package and super quality are my best favorable . Yes , they can do it and they have done that . I'm so happy...

—— Michael Decapvcca-UK

I fazer negócios com Eric, ele é sempre responsável por seus clientes. Quando cheguei em apuros, ele iria me ajudar a resolvê-los. sentir-se melhor

—— PRISCILLA DE OLIVEIRA-Brasil

I'm Online Chat Now

injectable testosterone steroids

(266)
China White Raw Powder Corticosteroids Immunosuppressive  52-21-1 Prednisolone Acetate factory

White Raw Powder Corticosteroids Immunosuppressive 52-21-1 Prednisolone Acetate

White Raw Powder Corticosteroids Immunosuppressive 52-21-1 Prednisolone Acetate Product namePrednisolone AcetateCAS52-21-1 Purity99%AppearanceWhite powdersSkypenjbnsteroidUsageAnti-inflammatoryWhatsApp... Read More
2018-07-26 10:34:30
China CAS 863288-34-0 CJC-1295 Body Building Peptides for Increase GH Production factory

CAS 863288-34-0 CJC-1295 Body Building Peptides for Increase GH Production

Hot Sell Body Building Peptides CAS 863288-34-0 CJC-1295 for Increase GH Production Quick Detail: Product Name CJC1295 Synonyms CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl... Read More
2018-07-25 17:29:43
China 1165910-22-4 Oral Selective Androgen Receptor Modulators SARMS LGD-4033 factory

1165910-22-4 Oral Selective Androgen Receptor Modulators SARMS LGD-4033

1165910-22-4 Oral Selective Androgen Receptor Modulators SARMS LGD-4033 Quick Details of Selective Androgen Receptor Modulators SARMS LGD-4033 Product name SARMS LGD-4033 Original China Synonyms Ligandrol; 4-(... Read More
2018-07-26 10:36:12
China Triptorelin Acetate 57773-63-4 Bodybuilding Polypeptide Hormone Powders Triptorelin 2mg factory

Triptorelin Acetate 57773-63-4 Bodybuilding Polypeptide Hormone Powders Triptorelin 2mg

Triptorelin Acetate 57773-63-4 Bodybuilding Polypeptide Hormones Triptorelin 2mg Buy Online Quick Details for Triptorelin Product Name : Triptorelin Acetate Cas No.: 57773-63-4 Sequence: Glp-His-Trp-Ser-Tyr-D... Read More
2018-07-25 12:02:02
China High Purity Pharmaceutical Human Growth Hormone Peptides TB-500 CAS 77591-33-4 factory

High Purity Pharmaceutical Human Growth Hormone Peptides TB-500 CAS 77591-33-4

2mg/Vial Pharmaceutical Human Growth Steroid Hormone Peptide TB-500 CAS 77591-33-4 Quick Details for TB500 Product Name : TB500Other name:Thymosin Beta-4 AcetateSequence: Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile... Read More
2018-07-25 12:02:06
China Melanotan 2 Growth Hormone Releasing Peptide CAS 121062-08-6 For Skin Cancer factory

Melanotan 2 Growth Hormone Releasing Peptide CAS 121062-08-6 For Skin Cancer

Melanotan 2 Growth Hormone Releasing Peptide CAS 121062-08-6 For Skin Cancer Basic Information: Product Name Melanotan 2 Alias MalanotanIi CAS 121062-08-6 Purity 99.0% Grade Pharmaceutical Grade Brand Name NJBN ... Read More
2018-07-26 10:05:58
China Fat Loss Legal Growth Hormone Peptides Ipamorelin CAS 170851-70-4 factory

Fat Loss Legal Growth Hormone Peptides Ipamorelin CAS 170851-70-4

Fat Loss Legal Growth Hormone Peptides Ipamorelin CAS 170851-70-4 Growth Hormone Peptides Quick Detail : Ipamorelin CAS:170851-70-4 MF:C38H49N9O5 MW:711.863 Packing:5mg/vial, 10vial/box Appearance: White powder ... Read More
2018-07-26 10:36:57
China Glucocorticoid Steroids Male Hair Loss Drugs 164656-23-9 Dutasteride for sale factory

Glucocorticoid Steroids Male Hair Loss Drugs 164656-23-9 Dutasteride for sale

Glucocorticoid Steroids Male Hair Loss Drugs 164656-23-9 Dutasteride for sale 1. Dutasteride (164656-23-9) Specifications Product name Dutasteride Batch No. DTS-160301 Quantity 15kg Mfg. Date Mar.,04, 2016 ... Read More
2018-07-26 10:27:47
China GHRP-6 CAS 87616-84-0 Growth Hormone Peptides For Muscle Gain White Powder factory

GHRP-6 CAS 87616-84-0 Growth Hormone Peptides For Muscle Gain White Powder

GHRP-6 CAS 87616-84-0 Growth Hormone Peptides For Muscle Gain White Powder Basic Infomation: Product Name GHRP-6 Alias GHRP-6 ACETATE CAS 87616-84-0 Purity 99.0% Grade Pharmaceutical Grade Brand Name NJBN ... Read More
2018-07-26 10:04:44
China PEG MGF Growth Hormone Peptides For Fat Loss And Muscle Gain Powder MGF 221231-10-3 factory

PEG MGF Growth Hormone Peptides For Fat Loss And Muscle Gain Powder MGF 221231-10-3

PEG MGF Growth Hormone Peptides For Fat Loss And Muscle Gain Powder MGF 221231-10-3 Quick Details for PEG MGF Product name : PEG MGF Other name : Testoviron Peg-Mgf CAS register number : 221231-10-3 Form & ... Read More
2018-07-25 12:02:10
Page 23 of 27|< 18 19 20 21 22 23 24 25 26 27 >|